Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for jausmh 111. jausmh Lv 1 3 pts. 9,635
  2. Avatar for puxatudo 112. puxatudo Lv 1 3 pts. 9,633
  3. Avatar for iplfd 113. iplfd Lv 1 3 pts. 9,626
  4. Avatar for ShadowTactics 114. ShadowTactics Lv 1 3 pts. 9,618
  5. Avatar for knotartist 115. knotartist Lv 1 3 pts. 9,595
  6. Avatar for alyssa_d_V2.0 116. alyssa_d_V2.0 Lv 1 3 pts. 9,587
  7. Avatar for JasperD 117. JasperD Lv 1 2 pts. 9,576
  8. Avatar for DoctorSockrates 118. DoctorSockrates Lv 1 2 pts. 9,570
  9. Avatar for Lotus23 119. Lotus23 Lv 1 2 pts. 9,565
  10. Avatar for abiogenesis 120. abiogenesis Lv 1 2 pts. 9,543

Comments