Placeholder image of a protein
Icon representing a puzzle

1845: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
May 28, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,241
  2. Avatar for Contenders 2. Contenders 74 pts. 10,207
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,185
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 10,162
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,125
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,122
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,108
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,058
  9. Avatar for Hold My Beer 9. Hold My Beer 5 pts. 10,013
  10. Avatar for CHNO Junkies 10. CHNO Junkies 3 pts. 9,998
  1. Avatar for roman madala 91. roman madala Lv 1 7 pts. 9,786
  2. Avatar for MrZanav 92. MrZanav Lv 1 7 pts. 9,781
  3. Avatar for silent gene 93. silent gene Lv 1 6 pts. 9,776
  4. Avatar for Formula350 94. Formula350 Lv 1 6 pts. 9,763
  5. Avatar for alcor29 95. alcor29 Lv 1 6 pts. 9,755
  6. Avatar for sciencewalker 96. sciencewalker Lv 1 6 pts. 9,750
  7. Avatar for Pikkachurin 97. Pikkachurin Lv 1 5 pts. 9,749
  8. Avatar for sitlux 98. sitlux Lv 1 5 pts. 9,744
  9. Avatar for Trajan464 99. Trajan464 Lv 1 5 pts. 9,738
  10. Avatar for dahast.de 100. dahast.de Lv 1 5 pts. 9,736

Comments