Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,341
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 9,334
  3. Avatar for CHNO Junkies 13. CHNO Junkies 2 pts. 9,215
  4. Avatar for Kangwon_National_University_Computers_in_Chemistry 14. Kangwon_National_University_Computers_in_Chemistry 1 pt. 8,823
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,807
  6. Avatar for Team Canada 16. Team Canada 1 pt. 7,988
  7. Avatar for Chem Eng Thermo 17. Chem Eng Thermo 1 pt. 7,633
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 7,199
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 7,134
  10. Avatar for Italiani Al Lavoro 20. Italiani Al Lavoro 1 pt. 2,801
  1. Avatar for dldahlen 101. dldahlen Lv 1 3 pts. 9,111
  2. Avatar for Altercomp 102. Altercomp Lv 1 3 pts. 9,109
  3. Avatar for SWR_DMaster 103. SWR_DMaster Lv 1 3 pts. 9,050
  4. Avatar for RyeSnake 104. RyeSnake Lv 1 2 pts. 9,040
  5. Avatar for Trajan464 105. Trajan464 Lv 1 2 pts. 9,028
  6. Avatar for Jpilkington 106. Jpilkington Lv 1 2 pts. 9,027
  7. Avatar for diamonddays 107. diamonddays Lv 1 2 pts. 8,989
  8. Avatar for kevin everington 108. kevin everington Lv 1 2 pts. 8,973
  9. Avatar for jtrube1 109. jtrube1 Lv 1 2 pts. 8,966
  10. Avatar for Simek 110. Simek Lv 1 2 pts. 8,948

Comments