Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,785
  2. Avatar for Go Science 2. Go Science 78 pts. 10,734
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,674
  4. Avatar for Contenders 4. Contenders 45 pts. 10,550
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,449
  6. Avatar for Beta Folders 6. Beta Folders 24 pts. 10,443
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,375
  8. Avatar for Marvin's bunch 8. Marvin's bunch 12 pts. 10,351
  9. Avatar for Rechenkraft.net 9. Rechenkraft.net 8 pts. 9,907
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 9,739
  1. Avatar for dldahlen 101. dldahlen Lv 1 3 pts. 9,111
  2. Avatar for Altercomp 102. Altercomp Lv 1 3 pts. 9,109
  3. Avatar for SWR_DMaster 103. SWR_DMaster Lv 1 3 pts. 9,050
  4. Avatar for RyeSnake 104. RyeSnake Lv 1 2 pts. 9,040
  5. Avatar for Trajan464 105. Trajan464 Lv 1 2 pts. 9,028
  6. Avatar for Jpilkington 106. Jpilkington Lv 1 2 pts. 9,027
  7. Avatar for diamonddays 107. diamonddays Lv 1 2 pts. 8,989
  8. Avatar for kevin everington 108. kevin everington Lv 1 2 pts. 8,973
  9. Avatar for jtrube1 109. jtrube1 Lv 1 2 pts. 8,966
  10. Avatar for Simek 110. Simek Lv 1 2 pts. 8,948

Comments