Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 2,801

  1. Avatar for kludbrook 91. kludbrook Lv 1 4 pts. 9,203
  2. Avatar for sitlux 92. sitlux Lv 1 4 pts. 9,196
  3. Avatar for chlorowolf 93. chlorowolf Lv 1 4 pts. 9,191
  4. Avatar for SKSbell 94. SKSbell Lv 1 4 pts. 9,190
  5. Avatar for Chris Klassen 95. Chris Klassen Lv 1 4 pts. 9,169
  6. Avatar for Steven Pletsch 96. Steven Pletsch Lv 1 3 pts. 9,161
  7. Avatar for Vinara 97. Vinara Lv 1 3 pts. 9,138
  8. Avatar for Dhalion 98. Dhalion Lv 1 3 pts. 9,133
  9. Avatar for tom2705 99. tom2705 Lv 1 3 pts. 9,121
  10. Avatar for BarrySampson 100. BarrySampson Lv 1 3 pts. 9,116

Comments