Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 2,801

  1. Avatar for ichwilldiesennamen 161. ichwilldiesennamen Lv 1 1 pt. 7,735
  2. Avatar for G d S 162. G d S Lv 1 1 pt. 7,633
  3. Avatar for skovz99 163. skovz99 Lv 1 1 pt. 7,607
  4. Avatar for Brusnica 164. Brusnica Lv 1 1 pt. 7,550
  5. Avatar for Pyrodinium123 165. Pyrodinium123 Lv 1 1 pt. 7,511
  6. Avatar for YellowBearPL 166. YellowBearPL Lv 1 1 pt. 7,501
  7. Avatar for zo3xiaJonWeinberg 167. zo3xiaJonWeinberg Lv 1 1 pt. 7,437
  8. Avatar for Puttering 168. Puttering Lv 1 1 pt. 7,357
  9. Avatar for momadoc 169. momadoc Lv 1 1 pt. 7,315
  10. Avatar for frostschutz 170. frostschutz Lv 1 1 pt. 7,268

Comments