Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 2,801
  1. Avatar for DoctorSockrates 181. DoctorSockrates Lv 1 1 pt. 4,344
  2. Avatar for Janvanomme 182. Janvanomme Lv 1 1 pt. 3,283
  3. Avatar for lconor 183. lconor Lv 1 1 pt. 2,801
  4. Avatar for ucad 184. ucad Lv 1 1 pt. 2,801
  5. Avatar for puxatudo 185. puxatudo Lv 1 1 pt. 2,801
  6. Avatar for Mike Lewis 186. Mike Lewis Lv 1 1 pt. 2,801
  7. Avatar for PMiglionico 187. PMiglionico Lv 1 1 pt. 2,801
  8. Avatar for aspadistra 188. aspadistra Lv 1 1 pt. 2,801
  9. Avatar for perimundo 189. perimundo Lv 1 1 pt. 2,801

Comments