Placeholder image of a protein
Icon representing a puzzle

1851: Revisiting Puzzle 134: Rice

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary

Created
June 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 2,801
  1. Avatar for iplfd 71. iplfd Lv 1 10 pts. 9,650
  2. Avatar for drumpeter18yrs9yrs 72. drumpeter18yrs9yrs Lv 1 10 pts. 9,557
  3. Avatar for infjamc 73. infjamc Lv 1 9 pts. 9,536
  4. Avatar for Alistair69 74. Alistair69 Lv 1 9 pts. 9,469
  5. Avatar for CAN1958 75. CAN1958 Lv 1 9 pts. 9,445
  6. Avatar for Merf 76. Merf Lv 1 8 pts. 9,416
  7. Avatar for abiogenesis 77. abiogenesis Lv 1 8 pts. 9,410
  8. Avatar for rout 78. rout Lv 1 8 pts. 9,408
  9. Avatar for xmbrst 79. xmbrst Lv 1 7 pts. 9,385
  10. Avatar for Tygh 80. Tygh Lv 1 7 pts. 9,369

Comments