Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 45 pts. 9,549
  2. Avatar for robgee 32. robgee Lv 1 44 pts. 9,545
  3. Avatar for Bletchley Park 33. Bletchley Park Lv 1 43 pts. 9,533
  4. Avatar for Mikisp 34. Mikisp Lv 1 41 pts. 9,528
  5. Avatar for johnmitch 35. johnmitch Lv 1 40 pts. 9,521
  6. Avatar for lraguette 36. lraguette Lv 1 39 pts. 9,521
  7. Avatar for Tygh 37. Tygh Lv 1 38 pts. 9,513
  8. Avatar for ichwilldiesennamen 38. ichwilldiesennamen Lv 1 37 pts. 9,506
  9. Avatar for TastyMunchies 39. TastyMunchies Lv 1 36 pts. 9,505
  10. Avatar for silent gene 40. silent gene Lv 1 35 pts. 9,501

Comments