Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for dfonda 111. dfonda Lv 1 2 pts. 9,019
  2. Avatar for zannipietro 112. zannipietro Lv 1 2 pts. 9,008
  3. Avatar for rabamino12358 113. rabamino12358 Lv 1 2 pts. 9,004
  4. Avatar for fishercat 114. fishercat Lv 1 2 pts. 8,984
  5. Avatar for pente_player 115. pente_player Lv 1 2 pts. 8,971
  6. Avatar for lconor 116. lconor Lv 1 2 pts. 8,952
  7. Avatar for JasperD 117. JasperD Lv 1 2 pts. 8,951
  8. Avatar for jsmith86 118. jsmith86 Lv 1 2 pts. 8,939
  9. Avatar for Jpilkington 119. Jpilkington Lv 1 2 pts. 8,935
  10. Avatar for Sadaharu06.jp 120. Sadaharu06.jp Lv 1 2 pts. 8,930

Comments