Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394
  1. Avatar for dfonda 111. dfonda Lv 1 2 pts. 9,019
  2. Avatar for zannipietro 112. zannipietro Lv 1 2 pts. 9,008
  3. Avatar for rabamino12358 113. rabamino12358 Lv 1 2 pts. 9,004
  4. Avatar for fishercat 114. fishercat Lv 1 2 pts. 8,984
  5. Avatar for pente_player 115. pente_player Lv 1 2 pts. 8,971
  6. Avatar for lconor 116. lconor Lv 1 2 pts. 8,952
  7. Avatar for JasperD 117. JasperD Lv 1 2 pts. 8,951
  8. Avatar for jsmith86 118. jsmith86 Lv 1 2 pts. 8,939
  9. Avatar for Jpilkington 119. Jpilkington Lv 1 2 pts. 8,935
  10. Avatar for Sadaharu06.jp 120. Sadaharu06.jp Lv 1 2 pts. 8,930

Comments