Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  6. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  7. Avatar for Deleted group 18. Deleted group pts. 7,553

  1. Avatar for sitlux 121. sitlux Lv 1 2 pts. 8,922
  2. Avatar for Auntecedent 122. Auntecedent Lv 1 2 pts. 8,892
  3. Avatar for Pawel Tluscik 123. Pawel Tluscik Lv 1 1 pt. 8,888
  4. Avatar for chlorowolf 124. chlorowolf Lv 1 1 pt. 8,860
  5. Avatar for Trajan464 125. Trajan464 Lv 1 1 pt. 8,855
  6. Avatar for 181818 126. 181818 Lv 1 1 pt. 8,812
  7. Avatar for AlkiP0Ps 127. AlkiP0Ps Lv 1 1 pt. 8,800
  8. Avatar for pfirth 128. pfirth Lv 1 1 pt. 8,791
  9. Avatar for G d S 129. G d S Lv 1 1 pt. 8,791
  10. Avatar for dahast.de 130. dahast.de Lv 1 1 pt. 8,755

Comments