Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394
  1. Avatar for sitlux 121. sitlux Lv 1 2 pts. 8,922
  2. Avatar for Auntecedent 122. Auntecedent Lv 1 2 pts. 8,892
  3. Avatar for Pawel Tluscik 123. Pawel Tluscik Lv 1 1 pt. 8,888
  4. Avatar for chlorowolf 124. chlorowolf Lv 1 1 pt. 8,860
  5. Avatar for Trajan464 125. Trajan464 Lv 1 1 pt. 8,855
  6. Avatar for 181818 126. 181818 Lv 1 1 pt. 8,812
  7. Avatar for AlkiP0Ps 127. AlkiP0Ps Lv 1 1 pt. 8,800
  8. Avatar for pfirth 128. pfirth Lv 1 1 pt. 8,791
  9. Avatar for G d S 129. G d S Lv 1 1 pt. 8,791
  10. Avatar for dahast.de 130. dahast.de Lv 1 1 pt. 8,755

Comments