Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for CHNO Junkies 11. CHNO Junkies 2 pts. 9,340
  2. Avatar for Russian team 12. Russian team 1 pt. 9,312
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,308
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 9,264
  5. Avatar for Kangwon_National_University_Computers_in_Chemistry 15. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,034
  6. Avatar for Chem Eng Thermo 16. Chem Eng Thermo 1 pt. 8,791
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 8,143
  8. Avatar for Deleted group 18. Deleted group pts. 7,553
  1. Avatar for Rukh 181. Rukh Lv 1 1 pt. 7,523
  2. Avatar for harvardman 182. harvardman Lv 1 1 pt. 7,445
  3. Avatar for mOn12345 183. mOn12345 Lv 1 1 pt. 7,417
  4. Avatar for Corruption 184. Corruption Lv 1 1 pt. 7,325
  5. Avatar for Kunfa 185. Kunfa Lv 1 1 pt. 7,293
  6. Avatar for mwm64 186. mwm64 Lv 1 1 pt. 7,231
  7. Avatar for HMK 187. HMK Lv 1 1 pt. 7,151
  8. Avatar for Ricardo Oliveira 188. Ricardo Oliveira Lv 1 1 pt. 7,022
  9. Avatar for 01010011111 189. 01010011111 Lv 1 1 pt. 6,854
  10. Avatar for karmena 190. karmena Lv 1 1 pt. 6,262

Comments