Placeholder image of a protein
Icon representing a puzzle

1854: Revisiting Puzzle 135: E. Coli

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,753
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,740
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,735
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 9,649
  5. Avatar for Contenders 5. Contenders 27 pts. 9,646
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 9,635
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,624
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 9,488
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,437
  10. Avatar for SETI.Germany 10. SETI.Germany 3 pts. 9,394
  1. Avatar for kludbrook 71. kludbrook Lv 1 12 pts. 9,319
  2. Avatar for Hellcat6 72. Hellcat6 Lv 1 12 pts. 9,317
  3. Avatar for kyoota 73. kyoota Lv 1 12 pts. 9,312
  4. Avatar for hansvandenhof 74. hansvandenhof Lv 1 11 pts. 9,312
  5. Avatar for ShadowTactics 75. ShadowTactics Lv 1 11 pts. 9,308
  6. Avatar for Superphosphate 76. Superphosphate Lv 1 10 pts. 9,305
  7. Avatar for alwen 77. alwen Lv 1 10 pts. 9,297
  8. Avatar for stomjoh 78. stomjoh Lv 1 10 pts. 9,296
  9. Avatar for alcor29 79. alcor29 Lv 1 9 pts. 9,289
  10. Avatar for anton_rsol96 80. anton_rsol96 Lv 1 9 pts. 9,286

Comments