Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,106
  2. Avatar for Biochemistry-I-CSolisC 1 22. Biochemistry-I-CSolisC 1 1 pt. 0
  1. Avatar for Vinara 31. Vinara Lv 1 45 pts. 10,830
  2. Avatar for Pazithi 32. Pazithi Lv 1 44 pts. 10,796
  3. Avatar for TastyMunchies 33. TastyMunchies Lv 1 43 pts. 10,792
  4. Avatar for Deleted player 34. Deleted player pts. 10,792
  5. Avatar for BootsMcGraw 35. BootsMcGraw Lv 1 40 pts. 10,791
  6. Avatar for nicobul 36. nicobul Lv 1 39 pts. 10,771
  7. Avatar for phi16 37. phi16 Lv 1 38 pts. 10,759
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 37 pts. 10,748
  9. Avatar for Alistair69 39. Alistair69 Lv 1 36 pts. 10,744
  10. Avatar for OWM3 40. OWM3 Lv 1 35 pts. 10,720

Comments