Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,871
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,782
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,723
  4. Avatar for Deleted group 14. Deleted group pts. 10,709
  5. Avatar for GBHS BMAH kids 15. GBHS BMAH kids 1 pt. 10,648
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,640
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 10,402
  1. Avatar for Evica 61. Evica Lv 1 13 pts. 11,127
  2. Avatar for knotartist 62. knotartist Lv 1 13 pts. 11,118
  3. Avatar for KarenCH 63. KarenCH Lv 1 12 pts. 11,115
  4. Avatar for Pawel Tluscik 64. Pawel Tluscik Lv 1 12 pts. 11,103
  5. Avatar for pfirth 65. pfirth Lv 1 11 pts. 11,102
  6. Avatar for sitlux 66. sitlux Lv 1 11 pts. 11,101
  7. Avatar for RockOn 67. RockOn Lv 1 10 pts. 11,097
  8. Avatar for nicobul 68. nicobul Lv 1 10 pts. 11,078
  9. Avatar for lynnai 69. lynnai Lv 1 10 pts. 11,059
  10. Avatar for jsfoldingaccount 70. jsfoldingaccount Lv 1 9 pts. 11,048

Comments

LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.