Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for matt61ger 91. matt61ger Lv 1 3 pts. 9,499
  2. Avatar for GuR0 92. GuR0 Lv 1 2 pts. 9,491
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 2 pts. 9,490
  4. Avatar for Hellcat6 94. Hellcat6 Lv 1 2 pts. 9,459
  5. Avatar for Mohoernchen 95. Mohoernchen Lv 1 2 pts. 9,455
  6. Avatar for Hansgeorg 96. Hansgeorg Lv 1 2 pts. 9,417
  7. Avatar for vuvuvu 97. vuvuvu Lv 1 2 pts. 9,398
  8. Avatar for bcre8tvv 98. bcre8tvv Lv 1 2 pts. 9,397
  9. Avatar for Philzord 99. Philzord Lv 1 2 pts. 9,379
  10. Avatar for tracybutt 100. tracybutt Lv 1 2 pts. 9,378

Comments