Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for matt61ger 91. matt61ger Lv 1 3 pts. 9,499
  2. Avatar for GuR0 92. GuR0 Lv 1 2 pts. 9,491
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 2 pts. 9,490
  4. Avatar for Hellcat6 94. Hellcat6 Lv 1 2 pts. 9,459
  5. Avatar for Mohoernchen 95. Mohoernchen Lv 1 2 pts. 9,455
  6. Avatar for Hansgeorg 96. Hansgeorg Lv 1 2 pts. 9,417
  7. Avatar for vuvuvu 97. vuvuvu Lv 1 2 pts. 9,398
  8. Avatar for bcre8tvv 98. bcre8tvv Lv 1 2 pts. 9,397
  9. Avatar for Philzord 99. Philzord Lv 1 2 pts. 9,379
  10. Avatar for tracybutt 100. tracybutt Lv 1 2 pts. 9,378

Comments