Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for matt61ger 91. matt61ger Lv 1 3 pts. 9,499
  2. Avatar for GuR0 92. GuR0 Lv 1 2 pts. 9,491
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 2 pts. 9,490
  4. Avatar for Hellcat6 94. Hellcat6 Lv 1 2 pts. 9,459
  5. Avatar for Mohoernchen 95. Mohoernchen Lv 1 2 pts. 9,455
  6. Avatar for Hansgeorg 96. Hansgeorg Lv 1 2 pts. 9,417
  7. Avatar for vuvuvu 97. vuvuvu Lv 1 2 pts. 9,398
  8. Avatar for bcre8tvv 98. bcre8tvv Lv 1 2 pts. 9,397
  9. Avatar for Philzord 99. Philzord Lv 1 2 pts. 9,379
  10. Avatar for tracybutt 100. tracybutt Lv 1 2 pts. 9,378

Comments