Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for AlkiP0Ps 131. AlkiP0Ps Lv 1 1 pt. 8,803
  2. Avatar for zo3xiaJonWeinberg 132. zo3xiaJonWeinberg Lv 1 1 pt. 8,802
  3. Avatar for essemiyagi 133. essemiyagi Lv 1 1 pt. 8,801
  4. Avatar for joshmiller 134. joshmiller Lv 1 1 pt. 8,793
  5. Avatar for evifnoskcaj 135. evifnoskcaj Lv 1 1 pt. 8,782
  6. Avatar for benjimoos 136. benjimoos Lv 1 1 pt. 8,781
  7. Avatar for frostschutz 137. frostschutz Lv 1 1 pt. 8,780
  8. Avatar for chlorowolf 138. chlorowolf Lv 1 1 pt. 8,780
  9. Avatar for pattyloof 139. pattyloof Lv 1 1 pt. 8,779
  10. Avatar for martinf 140. martinf Lv 1 1 pt. 8,778

Comments