Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for AlkiP0Ps 131. AlkiP0Ps Lv 1 1 pt. 8,803
  2. Avatar for zo3xiaJonWeinberg 132. zo3xiaJonWeinberg Lv 1 1 pt. 8,802
  3. Avatar for essemiyagi 133. essemiyagi Lv 1 1 pt. 8,801
  4. Avatar for joshmiller 134. joshmiller Lv 1 1 pt. 8,793
  5. Avatar for evifnoskcaj 135. evifnoskcaj Lv 1 1 pt. 8,782
  6. Avatar for benjimoos 136. benjimoos Lv 1 1 pt. 8,781
  7. Avatar for frostschutz 137. frostschutz Lv 1 1 pt. 8,780
  8. Avatar for chlorowolf 138. chlorowolf Lv 1 1 pt. 8,780
  9. Avatar for pattyloof 139. pattyloof Lv 1 1 pt. 8,779
  10. Avatar for martinf 140. martinf Lv 1 1 pt. 8,778

Comments