Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for g_b 21. g_b Lv 1 53 pts. 11,023
  2. Avatar for georg137 22. georg137 Lv 1 51 pts. 11,020
  3. Avatar for spmm 23. spmm Lv 1 50 pts. 10,994
  4. Avatar for Deleted player 24. Deleted player 48 pts. 10,984
  5. Avatar for nicobul 25. nicobul Lv 1 46 pts. 10,977
  6. Avatar for Pazithi 26. Pazithi Lv 1 45 pts. 10,969
  7. Avatar for johnmitch 27. johnmitch Lv 1 43 pts. 10,904
  8. Avatar for fiendish_ghoul 28. fiendish_ghoul Lv 1 42 pts. 10,887
  9. Avatar for Jpilkington 29. Jpilkington Lv 1 40 pts. 10,859
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 39 pts. 10,853

Comments