Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for g_b 21. g_b Lv 1 53 pts. 11,023
  2. Avatar for georg137 22. georg137 Lv 1 51 pts. 11,020
  3. Avatar for spmm 23. spmm Lv 1 50 pts. 10,994
  4. Avatar for Deleted player 24. Deleted player 48 pts. 10,984
  5. Avatar for nicobul 25. nicobul Lv 1 46 pts. 10,977
  6. Avatar for Pazithi 26. Pazithi Lv 1 45 pts. 10,969
  7. Avatar for johnmitch 27. johnmitch Lv 1 43 pts. 10,904
  8. Avatar for fiendish_ghoul 28. fiendish_ghoul Lv 1 42 pts. 10,887
  9. Avatar for Jpilkington 29. Jpilkington Lv 1 40 pts. 10,859
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 39 pts. 10,853

Comments