Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for TastyMunchies 31. TastyMunchies Lv 1 37 pts. 10,818
  2. Avatar for robgee 32. robgee Lv 1 36 pts. 10,817
  3. Avatar for Deleted player 33. Deleted player pts. 10,808
  4. Avatar for Merf 34. Merf Lv 1 34 pts. 10,797
  5. Avatar for diamonddays 35. diamonddays Lv 1 32 pts. 10,786
  6. Avatar for Deleted player 36. Deleted player 31 pts. 10,782
  7. Avatar for silent gene 37. silent gene Lv 1 30 pts. 10,781
  8. Avatar for drjr 38. drjr Lv 1 29 pts. 10,742
  9. Avatar for Lotus23 39. Lotus23 Lv 1 28 pts. 10,719
  10. Avatar for jtrube1 40. jtrube1 Lv 1 27 pts. 10,699

Comments