Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for TastyMunchies 31. TastyMunchies Lv 1 37 pts. 10,818
  2. Avatar for robgee 32. robgee Lv 1 36 pts. 10,817
  3. Avatar for Deleted player 33. Deleted player pts. 10,808
  4. Avatar for Merf 34. Merf Lv 1 34 pts. 10,797
  5. Avatar for diamonddays 35. diamonddays Lv 1 32 pts. 10,786
  6. Avatar for Deleted player 36. Deleted player 31 pts. 10,782
  7. Avatar for silent gene 37. silent gene Lv 1 30 pts. 10,781
  8. Avatar for drjr 38. drjr Lv 1 29 pts. 10,742
  9. Avatar for Lotus23 39. Lotus23 Lv 1 28 pts. 10,719
  10. Avatar for jtrube1 40. jtrube1 Lv 1 27 pts. 10,699

Comments