Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for BootsMcGraw 51. BootsMcGraw Lv 1 17 pts. 10,396
  2. Avatar for Steven Pletsch 52. Steven Pletsch Lv 1 16 pts. 10,389
  3. Avatar for phi16 53. phi16 Lv 1 16 pts. 10,360
  4. Avatar for pvc78 54. pvc78 Lv 1 15 pts. 10,336
  5. Avatar for kyoota 55. kyoota Lv 1 14 pts. 10,323
  6. Avatar for infjamc 56. infjamc Lv 1 14 pts. 10,284
  7. Avatar for abiogenesis 57. abiogenesis Lv 1 13 pts. 10,268
  8. Avatar for Todd6485577 58. Todd6485577 Lv 1 13 pts. 10,264
  9. Avatar for borattt 59. borattt Lv 1 12 pts. 10,255
  10. Avatar for heather-1 60. heather-1 Lv 1 12 pts. 10,210

Comments