Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for BootsMcGraw 51. BootsMcGraw Lv 1 17 pts. 10,396
  2. Avatar for Steven Pletsch 52. Steven Pletsch Lv 1 16 pts. 10,389
  3. Avatar for phi16 53. phi16 Lv 1 16 pts. 10,360
  4. Avatar for pvc78 54. pvc78 Lv 1 15 pts. 10,336
  5. Avatar for kyoota 55. kyoota Lv 1 14 pts. 10,323
  6. Avatar for infjamc 56. infjamc Lv 1 14 pts. 10,284
  7. Avatar for abiogenesis 57. abiogenesis Lv 1 13 pts. 10,268
  8. Avatar for Todd6485577 58. Todd6485577 Lv 1 13 pts. 10,264
  9. Avatar for borattt 59. borattt Lv 1 12 pts. 10,255
  10. Avatar for heather-1 60. heather-1 Lv 1 12 pts. 10,210

Comments