Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for BootsMcGraw 51. BootsMcGraw Lv 1 17 pts. 10,396
  2. Avatar for Steven Pletsch 52. Steven Pletsch Lv 1 16 pts. 10,389
  3. Avatar for phi16 53. phi16 Lv 1 16 pts. 10,360
  4. Avatar for pvc78 54. pvc78 Lv 1 15 pts. 10,336
  5. Avatar for kyoota 55. kyoota Lv 1 14 pts. 10,323
  6. Avatar for infjamc 56. infjamc Lv 1 14 pts. 10,284
  7. Avatar for abiogenesis 57. abiogenesis Lv 1 13 pts. 10,268
  8. Avatar for Todd6485577 58. Todd6485577 Lv 1 13 pts. 10,264
  9. Avatar for borattt 59. borattt Lv 1 12 pts. 10,255
  10. Avatar for heather-1 60. heather-1 Lv 1 12 pts. 10,210

Comments