Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for harvardman 141. harvardman Lv 1 1 pt. 8,777
  2. Avatar for herc6 142. herc6 Lv 1 1 pt. 8,773
  3. Avatar for JeremyBeerkens 143. JeremyBeerkens Lv 1 1 pt. 8,764
  4. Avatar for neutralgreen 144. neutralgreen Lv 1 1 pt. 8,763
  5. Avatar for Orbiz 145. Orbiz Lv 1 1 pt. 8,742
  6. Avatar for Mateo Ian 146. Mateo Ian Lv 1 1 pt. 8,726
  7. Avatar for Osiris 147. Osiris Lv 1 1 pt. 8,723
  8. Avatar for The Antichrist 148. The Antichrist Lv 1 1 pt. 8,703
  9. Avatar for matvargas11 149. matvargas11 Lv 1 1 pt. 8,700
  10. Avatar for Scopper 150. Scopper Lv 1 1 pt. 8,691

Comments