Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups


  1. Avatar for Beta Folders 100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323

  1. Avatar for CAN1958 101. CAN1958 Lv 1 1 pt. 9,351
  2. Avatar for jsfoldingaccount 102. jsfoldingaccount Lv 1 1 pt. 9,339
  3. Avatar for sitlux 104. sitlux Lv 1 1 pt. 9,332
  4. Avatar for Sadaharu06.jp 105. Sadaharu06.jp Lv 1 1 pt. 9,331
  5. Avatar for skovz99 106. skovz99 Lv 1 1 pt. 9,307
  6. Avatar for Bearpaw 107. Bearpaw Lv 1 1 pt. 9,298
  7. Avatar for rinze 109. rinze Lv 1 1 pt. 9,205
  8. Avatar for Arne Heessels 110. Arne Heessels Lv 1 1 pt. 9,167

Comments