Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for rabamino12358 101. rabamino12358 Lv 1 1 pt. 10,284
  2. Avatar for ProfVince 102. ProfVince Lv 1 1 pt. 10,227
  3. Avatar for harvardman 103. harvardman Lv 1 1 pt. 10,206
  4. Avatar for EagleGuy 104. EagleGuy Lv 1 1 pt. 10,181
  5. Avatar for cjddig 105. cjddig Lv 1 1 pt. 10,170
  6. Avatar for pruneau_44 106. pruneau_44 Lv 1 1 pt. 10,162
  7. Avatar for felimare 107. felimare Lv 1 1 pt. 10,160
  8. Avatar for drumpeter18yrs9yrs 108. drumpeter18yrs9yrs Lv 1 1 pt. 10,157
  9. Avatar for skovz99 109. skovz99 Lv 1 1 pt. 10,143
  10. Avatar for sitlux 110. sitlux Lv 1 1 pt. 10,125

Comments