Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for rabamino12358 101. rabamino12358 Lv 1 1 pt. 10,284
  2. Avatar for ProfVince 102. ProfVince Lv 1 1 pt. 10,227
  3. Avatar for harvardman 103. harvardman Lv 1 1 pt. 10,206
  4. Avatar for EagleGuy 104. EagleGuy Lv 1 1 pt. 10,181
  5. Avatar for cjddig 105. cjddig Lv 1 1 pt. 10,170
  6. Avatar for pruneau_44 106. pruneau_44 Lv 1 1 pt. 10,162
  7. Avatar for felimare 107. felimare Lv 1 1 pt. 10,160
  8. Avatar for drumpeter18yrs9yrs 108. drumpeter18yrs9yrs Lv 1 1 pt. 10,157
  9. Avatar for skovz99 109. skovz99 Lv 1 1 pt. 10,143
  10. Avatar for sitlux 110. sitlux Lv 1 1 pt. 10,125

Comments