Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for alyssa_d_V2.0 141. alyssa_d_V2.0 Lv 1 1 pt. 9,815
  2. Avatar for Dinkar 142. Dinkar Lv 1 1 pt. 9,803
  3. Avatar for MariFer 143. MariFer Lv 1 1 pt. 9,792
  4. Avatar for Sunmurder 144. Sunmurder Lv 1 1 pt. 9,271
  5. Avatar for Huschiro 145. Huschiro Lv 1 1 pt. 8,756
  6. Avatar for ManVsYard 146. ManVsYard Lv 1 1 pt. 8,737
  7. Avatar for Dearlove_45204233 147. Dearlove_45204233 Lv 1 1 pt. 8,699
  8. Avatar for lenny1 148. lenny1 Lv 1 1 pt. 8,418
  9. Avatar for Savia 149. Savia Lv 1 1 pt. 8,195
  10. Avatar for kangchingfan 150. kangchingfan Lv 1 1 pt. 7,101

Comments