Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990

  1. Avatar for alyssa_d_V2.0 141. alyssa_d_V2.0 Lv 1 1 pt. 9,815
  2. Avatar for Dinkar 142. Dinkar Lv 1 1 pt. 9,803
  3. Avatar for MariFer 143. MariFer Lv 1 1 pt. 9,792
  4. Avatar for Sunmurder 144. Sunmurder Lv 1 1 pt. 9,271
  5. Avatar for Huschiro 145. Huschiro Lv 1 1 pt. 8,756
  6. Avatar for ManVsYard 146. ManVsYard Lv 1 1 pt. 8,737
  7. Avatar for Dearlove_45204233 147. Dearlove_45204233 Lv 1 1 pt. 8,699
  8. Avatar for lenny1 148. lenny1 Lv 1 1 pt. 8,418
  9. Avatar for Savia 149. Savia Lv 1 1 pt. 8,195
  10. Avatar for kangchingfan 150. kangchingfan Lv 1 1 pt. 7,101

Comments