Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for Galaxie 11. Galaxie Lv 1 72 pts. 11,398
  2. Avatar for silent gene 12. silent gene Lv 1 69 pts. 11,390
  3. Avatar for Aubade01 13. Aubade01 Lv 1 67 pts. 11,383
  4. Avatar for mirp 14. mirp Lv 1 65 pts. 11,374
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 62 pts. 11,364
  6. Avatar for TastyMunchies 16. TastyMunchies Lv 1 60 pts. 11,356
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 58 pts. 11,348
  8. Avatar for LociOiling 18. LociOiling Lv 1 56 pts. 11,345
  9. Avatar for Phyx 19. Phyx Lv 1 54 pts. 11,321
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 52 pts. 11,320

Comments