Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for Galaxie 11. Galaxie Lv 1 72 pts. 11,398
  2. Avatar for silent gene 12. silent gene Lv 1 69 pts. 11,390
  3. Avatar for Aubade01 13. Aubade01 Lv 1 67 pts. 11,383
  4. Avatar for mirp 14. mirp Lv 1 65 pts. 11,374
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 62 pts. 11,364
  6. Avatar for TastyMunchies 16. TastyMunchies Lv 1 60 pts. 11,356
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 58 pts. 11,348
  8. Avatar for LociOiling 18. LociOiling Lv 1 56 pts. 11,345
  9. Avatar for Phyx 19. Phyx Lv 1 54 pts. 11,321
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 52 pts. 11,320

Comments