Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990

  1. Avatar for Galaxie 11. Galaxie Lv 1 72 pts. 11,398
  2. Avatar for silent gene 12. silent gene Lv 1 69 pts. 11,390
  3. Avatar for Aubade01 13. Aubade01 Lv 1 67 pts. 11,383
  4. Avatar for mirp 14. mirp Lv 1 65 pts. 11,374
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 62 pts. 11,364
  6. Avatar for TastyMunchies 16. TastyMunchies Lv 1 60 pts. 11,356
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 58 pts. 11,348
  8. Avatar for LociOiling 18. LociOiling Lv 1 56 pts. 11,345
  9. Avatar for Phyx 19. Phyx Lv 1 54 pts. 11,321
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 52 pts. 11,320

Comments