Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for g_b 21. g_b Lv 1 50 pts. 11,317
  2. Avatar for phi16 22. phi16 Lv 1 48 pts. 11,317
  3. Avatar for spmm 23. spmm Lv 1 47 pts. 11,313
  4. Avatar for nicobul 24. nicobul Lv 1 45 pts. 11,298
  5. Avatar for Bruno Kestemont 25. Bruno Kestemont Lv 1 43 pts. 11,291
  6. Avatar for pauldunn 26. pauldunn Lv 1 41 pts. 11,275
  7. Avatar for RockOn 27. RockOn Lv 1 40 pts. 11,275
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 38 pts. 11,245
  9. Avatar for grogar7 29. grogar7 Lv 1 37 pts. 11,240
  10. Avatar for Tygh 30. Tygh Lv 1 35 pts. 11,232

Comments