Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for g_b 21. g_b Lv 1 50 pts. 11,317
  2. Avatar for phi16 22. phi16 Lv 1 48 pts. 11,317
  3. Avatar for spmm 23. spmm Lv 1 47 pts. 11,313
  4. Avatar for nicobul 24. nicobul Lv 1 45 pts. 11,298
  5. Avatar for Bruno Kestemont 25. Bruno Kestemont Lv 1 43 pts. 11,291
  6. Avatar for pauldunn 26. pauldunn Lv 1 41 pts. 11,275
  7. Avatar for RockOn 27. RockOn Lv 1 40 pts. 11,275
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 38 pts. 11,245
  9. Avatar for grogar7 29. grogar7 Lv 1 37 pts. 11,240
  10. Avatar for Tygh 30. Tygh Lv 1 35 pts. 11,232

Comments