Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 34 pts. 11,211
  2. Avatar for OWM3 32. OWM3 Lv 1 33 pts. 11,194
  3. Avatar for BootsMcGraw 33. BootsMcGraw Lv 1 31 pts. 11,183
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 30 pts. 11,174
  5. Avatar for John McLeod 35. John McLeod Lv 1 29 pts. 11,168
  6. Avatar for johnmitch 36. johnmitch Lv 1 28 pts. 11,146
  7. Avatar for Pazithi 37. Pazithi Lv 1 27 pts. 11,143
  8. Avatar for GuR0 38. GuR0 Lv 1 26 pts. 11,139
  9. Avatar for Alistair69 39. Alistair69 Lv 1 24 pts. 11,129
  10. Avatar for robgee 40. robgee Lv 1 23 pts. 11,125

Comments