Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 34 pts. 11,211
  2. Avatar for OWM3 32. OWM3 Lv 1 33 pts. 11,194
  3. Avatar for BootsMcGraw 33. BootsMcGraw Lv 1 31 pts. 11,183
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 30 pts. 11,174
  5. Avatar for John McLeod 35. John McLeod Lv 1 29 pts. 11,168
  6. Avatar for johnmitch 36. johnmitch Lv 1 28 pts. 11,146
  7. Avatar for Pazithi 37. Pazithi Lv 1 27 pts. 11,143
  8. Avatar for GuR0 38. GuR0 Lv 1 26 pts. 11,139
  9. Avatar for Alistair69 39. Alistair69 Lv 1 24 pts. 11,129
  10. Avatar for robgee 40. robgee Lv 1 23 pts. 11,125

Comments