Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for pvc78 41. pvc78 Lv 1 22 pts. 11,111
  2. Avatar for fpc 42. fpc Lv 1 22 pts. 11,109
  3. Avatar for MrZanav 43. MrZanav Lv 1 21 pts. 11,105
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 20 pts. 11,077
  5. Avatar for aznarog 45. aznarog Lv 1 19 pts. 11,063
  6. Avatar for heather-1 46. heather-1 Lv 1 18 pts. 11,040
  7. Avatar for Visok 47. Visok Lv 1 17 pts. 11,018
  8. Avatar for ShadowTactics 48. ShadowTactics Lv 1 16 pts. 11,011
  9. Avatar for Steven Pletsch 49. Steven Pletsch Lv 1 16 pts. 10,990
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 15 pts. 10,940

Comments