Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for pvc78 41. pvc78 Lv 1 22 pts. 11,111
  2. Avatar for fpc 42. fpc Lv 1 22 pts. 11,109
  3. Avatar for MrZanav 43. MrZanav Lv 1 21 pts. 11,105
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 20 pts. 11,077
  5. Avatar for aznarog 45. aznarog Lv 1 19 pts. 11,063
  6. Avatar for heather-1 46. heather-1 Lv 1 18 pts. 11,040
  7. Avatar for Visok 47. Visok Lv 1 17 pts. 11,018
  8. Avatar for ShadowTactics 48. ShadowTactics Lv 1 16 pts. 11,011
  9. Avatar for Steven Pletsch 49. Steven Pletsch Lv 1 16 pts. 10,990
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 15 pts. 10,940

Comments