Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for CharlieFortsConscience 51. CharlieFortsConscience Lv 1 14 pts. 10,918
  2. Avatar for alcor29 52. alcor29 Lv 1 14 pts. 10,890
  3. Avatar for Pawel Tluscik 53. Pawel Tluscik Lv 1 13 pts. 10,875
  4. Avatar for joremen 54. joremen Lv 1 12 pts. 10,863
  5. Avatar for kyoota 55. kyoota Lv 1 12 pts. 10,825
  6. Avatar for JasperD 56. JasperD Lv 1 11 pts. 10,777
  7. Avatar for Mike Lewis 57. Mike Lewis Lv 1 11 pts. 10,759
  8. Avatar for Todd6485577 58. Todd6485577 Lv 1 10 pts. 10,759
  9. Avatar for spdenne 59. spdenne Lv 1 10 pts. 10,752
  10. Avatar for SaraL 60. SaraL Lv 1 9 pts. 10,746

Comments