Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for CharlieFortsConscience 51. CharlieFortsConscience Lv 1 14 pts. 10,918
  2. Avatar for alcor29 52. alcor29 Lv 1 14 pts. 10,890
  3. Avatar for Pawel Tluscik 53. Pawel Tluscik Lv 1 13 pts. 10,875
  4. Avatar for joremen 54. joremen Lv 1 12 pts. 10,863
  5. Avatar for kyoota 55. kyoota Lv 1 12 pts. 10,825
  6. Avatar for JasperD 56. JasperD Lv 1 11 pts. 10,777
  7. Avatar for Mike Lewis 57. Mike Lewis Lv 1 11 pts. 10,759
  8. Avatar for Todd6485577 58. Todd6485577 Lv 1 10 pts. 10,759
  9. Avatar for spdenne 59. spdenne Lv 1 10 pts. 10,752
  10. Avatar for SaraL 60. SaraL Lv 1 9 pts. 10,746

Comments