Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for CharlieFortsConscience 51. CharlieFortsConscience Lv 1 14 pts. 10,918
  2. Avatar for alcor29 52. alcor29 Lv 1 14 pts. 10,890
  3. Avatar for Pawel Tluscik 53. Pawel Tluscik Lv 1 13 pts. 10,875
  4. Avatar for joremen 54. joremen Lv 1 12 pts. 10,863
  5. Avatar for kyoota 55. kyoota Lv 1 12 pts. 10,825
  6. Avatar for JasperD 56. JasperD Lv 1 11 pts. 10,777
  7. Avatar for Mike Lewis 57. Mike Lewis Lv 1 11 pts. 10,759
  8. Avatar for Todd6485577 58. Todd6485577 Lv 1 10 pts. 10,759
  9. Avatar for spdenne 59. spdenne Lv 1 10 pts. 10,752
  10. Avatar for SaraL 60. SaraL Lv 1 9 pts. 10,746

Comments