Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for Nicm25 61. Nicm25 Lv 1 9 pts. 10,742
  2. Avatar for mrmookie 62. mrmookie Lv 1 8 pts. 10,737
  3. Avatar for drjr 63. drjr Lv 1 8 pts. 10,737
  4. Avatar for infjamc 64. infjamc Lv 1 8 pts. 10,732
  5. Avatar for jamiexq 65. jamiexq Lv 1 7 pts. 10,718
  6. Avatar for Psych0Active 66. Psych0Active Lv 1 7 pts. 10,716
  7. Avatar for Jpilkington 67. Jpilkington Lv 1 6 pts. 10,703
  8. Avatar for Vincera 68. Vincera Lv 1 6 pts. 10,694
  9. Avatar for Vinara 69. Vinara Lv 1 6 pts. 10,651
  10. Avatar for aendgraend 70. aendgraend Lv 1 5 pts. 10,611

Comments