Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for Nicm25 61. Nicm25 Lv 1 9 pts. 10,742
  2. Avatar for mrmookie 62. mrmookie Lv 1 8 pts. 10,737
  3. Avatar for drjr 63. drjr Lv 1 8 pts. 10,737
  4. Avatar for infjamc 64. infjamc Lv 1 8 pts. 10,732
  5. Avatar for jamiexq 65. jamiexq Lv 1 7 pts. 10,718
  6. Avatar for Psych0Active 66. Psych0Active Lv 1 7 pts. 10,716
  7. Avatar for Jpilkington 67. Jpilkington Lv 1 6 pts. 10,703
  8. Avatar for Vincera 68. Vincera Lv 1 6 pts. 10,694
  9. Avatar for Vinara 69. Vinara Lv 1 6 pts. 10,651
  10. Avatar for aendgraend 70. aendgraend Lv 1 5 pts. 10,611

Comments