Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990

  1. Avatar for tlaran 121. tlaran Lv 1 1 pt. 10,033
  2. Avatar for frostschutz 122. frostschutz Lv 1 1 pt. 10,024
  3. Avatar for tzugypsyl 123. tzugypsyl Lv 1 1 pt. 10,002
  4. Avatar for Alec_C 124. Alec_C Lv 1 1 pt. 9,973
  5. Avatar for chlorowolf 125. chlorowolf Lv 1 1 pt. 9,953
  6. Avatar for lolsnipesXD 126. lolsnipesXD Lv 1 1 pt. 9,937
  7. Avatar for 81189h 127. 81189h Lv 1 1 pt. 9,933
  8. Avatar for matfer 128. matfer Lv 1 1 pt. 9,923
  9. Avatar for roman madala 129. roman madala Lv 1 1 pt. 9,917
  10. Avatar for Superphosphate 130. Superphosphate Lv 1 1 pt. 9,913

Comments