Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for sitlux 111. sitlux Lv 1 1 pt. 10,658
  2. Avatar for cjddig 112. cjddig Lv 1 1 pt. 10,640
  3. Avatar for xbp 113. xbp Lv 1 1 pt. 10,610
  4. Avatar for zeluis 114. zeluis Lv 1 1 pt. 10,595
  5. Avatar for AlkiP0Ps 115. AlkiP0Ps Lv 1 1 pt. 10,591
  6. Avatar for roman madala 116. roman madala Lv 1 1 pt. 10,575
  7. Avatar for Kevonni 117. Kevonni Lv 1 1 pt. 10,556
  8. Avatar for fearjuan 118. fearjuan Lv 1 1 pt. 10,542
  9. Avatar for Mohoernchen 119. Mohoernchen Lv 1 1 pt. 10,538
  10. Avatar for tzugypsyl 120. tzugypsyl Lv 1 1 pt. 10,536

Comments