Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 3 pts. 11,151
  2. Avatar for tracybutt 82. tracybutt Lv 1 2 pts. 11,148
  3. Avatar for PieThrower 83. PieThrower Lv 1 2 pts. 11,113
  4. Avatar for HuubR 84. HuubR Lv 1 2 pts. 11,061
  5. Avatar for ShadowTactics 85. ShadowTactics Lv 1 2 pts. 11,055
  6. Avatar for hada 86. hada Lv 1 2 pts. 11,002
  7. Avatar for Beany 87. Beany Lv 1 2 pts. 10,963
  8. Avatar for Deleted player 88. Deleted player 2 pts. 10,953
  9. Avatar for CAN1958 89. CAN1958 Lv 1 2 pts. 10,948
  10. Avatar for zippyc137 90. zippyc137 Lv 1 2 pts. 10,947

Comments