Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 3 pts. 11,151
  2. Avatar for tracybutt 82. tracybutt Lv 1 2 pts. 11,148
  3. Avatar for PieThrower 83. PieThrower Lv 1 2 pts. 11,113
  4. Avatar for HuubR 84. HuubR Lv 1 2 pts. 11,061
  5. Avatar for ShadowTactics 85. ShadowTactics Lv 1 2 pts. 11,055
  6. Avatar for hada 86. hada Lv 1 2 pts. 11,002
  7. Avatar for Beany 87. Beany Lv 1 2 pts. 10,963
  8. Avatar for Deleted player 88. Deleted player 2 pts. 10,953
  9. Avatar for CAN1958 89. CAN1958 Lv 1 2 pts. 10,948
  10. Avatar for zippyc137 90. zippyc137 Lv 1 2 pts. 10,947

Comments