Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,519
  2. Avatar for Russian team 12. Russian team 1 pt. 11,206
  3. Avatar for Team Canada 13. Team Canada 1 pt. 10,862
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 10,665
  5. Avatar for Aalborghus 15. Aalborghus 1 pt. 10,137
  1. Avatar for EagleGuy 121. EagleGuy Lv 1 1 pt. 10,034
  2. Avatar for Maiaodon 122. Maiaodon Lv 1 1 pt. 10,025
  3. Avatar for Vincera 123. Vincera Lv 1 1 pt. 10,019
  4. Avatar for kludbrook 124. kludbrook Lv 1 1 pt. 9,999
  5. Avatar for RyeSnake 125. RyeSnake Lv 1 1 pt. 9,986
  6. Avatar for deathbat_87 126. deathbat_87 Lv 1 1 pt. 9,974
  7. Avatar for HuubR 127. HuubR Lv 1 1 pt. 9,971
  8. Avatar for tzugypsyl 128. tzugypsyl Lv 1 1 pt. 9,944
  9. Avatar for nmassot 129. nmassot Lv 1 1 pt. 9,932
  10. Avatar for Ashrai 130. Ashrai Lv 1 1 pt. 9,803

Comments