Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569

  1. Avatar for harvardman 141. harvardman Lv 1 1 pt. 9,349
  2. Avatar for jawz101 142. jawz101 Lv 1 1 pt. 9,139
  3. Avatar for The Antichrist 143. The Antichrist Lv 1 1 pt. 8,796
  4. Avatar for biotechnolog 144. biotechnolog Lv 1 1 pt. 8,746
  5. Avatar for Joanna_H 145. Joanna_H Lv 1 1 pt. 8,266
  6. Avatar for puxatudo 146. puxatudo Lv 1 1 pt. 8,266
  7. Avatar for xythus 147. xythus Lv 1 1 pt. 8,266
  8. Avatar for Susume 148. Susume Lv 1 1 pt. 8,266
  9. Avatar for kryptoid256 149. kryptoid256 Lv 1 1 pt. 8,266
  10. Avatar for EmmaVV 150. EmmaVV Lv 1 1 pt. 8,266

Comments